PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.013G124600.6
Common NameB456_013G124600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB_related
Protein Properties Length: 1150aa    MW: 128009 Da    PI: 9.5994
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.013G124600.6genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding29.91.3e-094484345
                        SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
     Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                        +W++ E e++++a +++G++ Wk++a+ +  +R+ +++  ++ 
  Gorai.013G124600.6 44 PWSKAEIERFYKAYREYGKD-WKKVAAAVR-NRSTEMVEAFYI 84
                        8*****************99.*********.****99988775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129311.5724093IPR017884SANT domain
SuperFamilySSF466892.17E-104088IPR009057Homeodomain-like
SMARTSM007171.7E-74189IPR001005SANT/Myb domain
CDDcd001677.47E-74483No hitNo description
PfamPF002491.9E-84485IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-54483IPR009057Homeodomain-like
PfamPF065841.9E-33652752IPR033471DIRP domain
SMARTSM011352.8E-57652753IPR033471DIRP domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1150 aa     Download sequence    Send to blast
MAPTRKYKSV NKQYSSKCEV SPDKDAGNSR KSNPKKLFDK LGPPWSKAEI ERFYKAYREY  60
GKDWKKVAAA VRNRSTEMVE AFYIMNRAYL SLPDGVASVI GLIAMMTDHY SVLGGSDAEI  120
ESNEPSKIPR KTQKRKRVKA HFGSSKEDVF LPQSIASTQG CLSLLKRIGF NGINPHAVGR  180
RTPRVPVSYS YRRDDMENYN PPKKRVKKSE ANDNDDEHVA AVTLTGALQR GSCPQFSQRP  240
YKKAECRRSA PVQCYDRMLL QSETTKAKLP SSSSKHRIES RHGGKEPVIG TYIKDTGPTE  300
DMEGAGTVEV REKGKKVYRK KVKAGEFINN LSDDGGEACS GIEEGIIDRA VKGKVEMEIS  360
RGKSKLSPWS QRKKSKKIVS GDESASLDAL LALANLSTSI SPASIIESEV SAKFKEDRIA  420
RETDEKPSAS EAASTSHRRD ETKHIGPKEK VLNLITEAED GTSRKSKVGR YSAKDDNVVS  480
EPKQQAESTN NSKKRKSKSF STSQLQISNP EARMDSPFIQ SFDNEDMAEE MNKSLTKGSS  540
AQSSVQSQQR KSFRVPEDSL TKNDPKFAET DSLVSTFQVP AESKLVSLPN KHQSRRKMNL  600
KRALLSTDIN SLNYTLANQP NKDSLSQDGL KERLSFCLSS NLARRWCSFE WFYSAIDYAW  660
FVKKEFVEYL NHVGLGHIPR LTRVEWGVIR SSLGKPRRFS ERFLHEEREK LKQYRESVRQ  720
HYAQLRIGTT EGLPTDLPQP LSIGQRVIAI HPETREVNDG KVLDLEHDSF KVQFDRPKLG  780
VELVTDIDCM PLNPLENLPE TLGSQNLAFD KFPATPNVSQ VNGHSDFRGS GVYAPSGHLE  840
NATSSVNMLA NPIKVDASRN VLNAKTSVPS VVAAHQTANG LPLTMAHIQG READIQVMSE  900
LNRALDKKEA ILMELRNTND DILDNKSGGN CLKGSEPFKK HIATVSSALH NLRQHNAYPA  960
NPVSPQQKPP TKSNFLGSLT SSIDSSLVSL ESDSVAGEIV EGSRLKAGSM VDAAIKAMSS  1020
TKEDEDPFMR IVEVLDSIDK LQFTPDIRMP VIKSAEPENG SISYQKHLVS RLPQNNEQVP  1080
SELITSCVAT LLMIRTCTER QFPPADVAQI MDLAARSLHP WCSENLWIYR EIQRCMGKIK  1140
TQILALIPT*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1360373RGKSKLSPWSQRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX5769731e-146JX576973.1 Gossypium hirsutum clone NBRI_GE8704 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012464718.10.0PREDICTED: protein ALWAYS EARLY 2 isoform X5
TrEMBLA0A0D2U0580.0A0A0D2U058_G
STRINGGLYMA20G37826.10.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G21430.21e-138DNA binding
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]